Customer service: Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN,90% purity, 5 MG

https://www.electalab.com/web/image/product.template/6178/image_1920?unique=5bc509a

1,099.00 € 1099.0 EUR 1,099.00 €

1,099.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days