Customer service:Sequence , MALFKELSNKELVNVNGGVVPVAVVLGVPTLALGIYQAGYAAGKDRAQAGLRR, 90% purity, 5 MG

https://www.electalab.com/web/image/product.template/6179/image_1920?unique=5bc509a

925.00 € 925.0 EUR 925.00 €

925.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days